DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and agap3

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_009295860.1 Gene:agap3 / 324332 ZFINID:ZDB-GENE-110927-1 Length:1295 Species:Danio rerio


Alignment Length:249 Identity:61/249 - (24%)
Similarity:81/249 - (32%) Gaps:93/249 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEK 74
            :|.::....||.|.:|...||.|.|:..|..||:||||.||:||.|||.|||:.:|.| .:||..
Zfish  1045 IQSIRNVRGNSFCADCDAPNPDWASLNLGALICIECSGMHRNLGTHLSRVRSLDLDDW-PVELSM 1108

  Fly    75 -MKAGGNRNAREF----------------LEDQEDWNERAPITQRYNSK---------------- 106
             |.|.||..|...                .|::|.|     |..:|..|                
Zfish  1109 VMTAIGNAMANSVWEACVDGYNKPGVDSTREEKERW-----IRAKYEQKLFVVALPQSDVPLGQQ 1168

  Fly   107 -AAALYRDK----IATLAQGKSWDLKEAQG----------------------------------- 131
             ..|:..|.    :..||.|...::.|..|                                   
Zfish  1169 LLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLSCAMANVVITQLLIWYGVDVKSRDA 1233

  Fly   132 ----------RVGSNNS----FSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAE 171
                      |.||...    ...|..:.....|.|:||.:..|....||..||
Zfish  1234 RGQTPLSYAQRAGSQECADILIQHGCPAEGGALSTPTATRHNPNINNNNGQCAE 1287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 42/137 (31%)
agap3XP_009295860.1 small_GTPase 507..672 CDD:197466
Centaurin_gamma 509..666 CDD:133303
PH_AGAP 778..1025 CDD:241281
PH 781..>845 CDD:278594
ArfGap 1044..1155 CDD:279720 41/115 (36%)
Ank_2 1190..1259 CDD:289560 5/68 (7%)
ANK 1199..>1259 CDD:238125 3/59 (5%)
ANK repeat 1201..1232 CDD:293786 0/30 (0%)
ANK repeat 1234..1259 CDD:293786 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.