DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and acap3a

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_021325699.1 Gene:acap3a / 322991 ZFINID:ZDB-GENE-030131-1711 Length:845 Species:Danio rerio


Alignment Length:215 Identity:56/215 - (26%)
Similarity:94/215 - (43%) Gaps:37/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKW 67
            |.|...:||.:.....|.:|.:|....|:|.|:..|:.:|:||||.|||||||.|.|||:|:|.|
Zfish   399 SVRGENILQRILSLPGNQQCCDCAQTEPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSW 463

  Fly    68 KDIELEKMKAGGNRNAREFLE---DQEDWNERAPITQRYNSKA--AALYRDK--IATLAQG---- 121
            :...|:.|...||.......|   :::...:.||.:.|...:|  .|.|.:|  :..:..|    
Zfish   464 EPELLKLMCELGNSIINHIYEGSCEEQGLKKPAPNSSRQEKEAWIKAKYVEKKFLKKMMTGEVVV 528

  Fly   122 -------KSWDLKEAQGRVGSNNSFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQYQ 179
                   :.|:.::.:    .:||.::...::..|:..|              |.|.|.......
Zfish   529 NGGRKSERRWNSRKCR----RHNSATTVPKTHRKYRQDP--------------GSASPATLSSAT 575

  Fly   180 TQ-EFKDQKEEFFSRRQVEN 198
            .. |.|.::|..|...:::|
Zfish   576 AALERKFRRESLFCPDELDN 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 39/111 (35%)
acap3aXP_021325699.1 BAR 16..215 CDD:325158
PH_ACAP 271..367 CDD:270070
ArfGap 403..520 CDD:307528 40/116 (34%)
ANK 674..790 CDD:238125
ANK repeat 674..700 CDD:293786
ANK repeat 702..735 CDD:293786
ANK repeat 737..762 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.