DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Acap1

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001099266.2 Gene:Acap1 / 287443 RGDID:1305360 Length:740 Species:Rattus norvegicus


Alignment Length:142 Identity:42/142 - (29%)
Similarity:67/142 - (47%) Gaps:31/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIEL 72
            :|..:::..|.|::|.:|....|:|.|:..||.:|::|||.|||||||.|.|||:|:|.|:...:
  Rat   406 QVAAQVQSVDGNAQCCDCKEPAPEWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELV 470

  Fly    73 EKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDK---IATLAQGKSW---------- 124
            :.|...||                ..|.|.|.::..|:...|   ..:..:.::|          
  Rat   471 KLMCELGN----------------VVINQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKF 519

  Fly   125 --DLKEAQGRVG 134
              .|.|.:||.|
  Rat   520 LTKLPEIRGRRG 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 35/105 (33%)
Acap1NP_001099266.2 BAR_ACAP1 18..217 CDD:153323
PH 266..360 CDD:278594
PH_ACAP 268..364 CDD:270070
ArfGap 406..519 CDD:279720 37/128 (29%)
ANK repeat 575..602 CDD:293786
ANK <592..692 CDD:238125
Ank_5 592..647 CDD:290568
ANK repeat 606..637 CDD:293786
Ank_5 626..680 CDD:290568
ANK repeat 639..670 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.