DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and APPL1

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_036228.1 Gene:APPL1 / 26060 HGNCID:24035 Length:709 Species:Homo sapiens


Alignment Length:236 Identity:44/236 - (18%)
Similarity:80/236 - (33%) Gaps:67/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GYQQYQTQEFK-------DQKEEFFS---------RRQVEN--------------ASRPENLPPS 208
            ||.|.|...||       :|.|||.:         ||::::              ||.|..:|..
Human   202 GYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDP 266

  Fly   209 QGGKY---------AGFGFTREPPPK-----------TQSQELFDSTLSTLASGWSLFSTNASKL 253
            ...|:         ||:...|.....           ||...|.......:|.|.::...|.|.:
Human   267 DPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVM 331

  Fly   254 ASTAKEKAVTTVNLASTKIKEGTLLDSVQ--------CGVTDVASKVTDMGKRGWNNLAGSNISS 310
            |...:::.. ...:.|...|:.::|.:..        |.:.:: ||...:.:......|..|.|:
Human   332 AVDCEDRRY-CFQITSFDGKKSSILQAESKKDHEEWICTINNI-SKQIYLSENPEETAARVNQSA 394

  Fly   311 PQGGYNDPNFED-------SSAYQRSNSVGGNLAGGLGQQS 344
            .:.....|:|:.       ::...|..:...:.:|.||.:|
Human   395 LEAVTPSPSFQQRHESLRPAAGQSRPPTARTSSSGSLGSES 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720
APPL1NP_036228.1 Required for RAB5A binding 1..428 40/227 (18%)
BAR_APPL1 20..234 CDD:153315 10/31 (32%)
BAR-PH_APPL 252..376 CDD:270067 21/125 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..434 6/36 (17%)
F&H 403..414 1/10 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..491
PTB_APPL 490..625 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.