DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Acap1

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_722483.2 Gene:Acap1 / 216859 MGIID:2388270 Length:740 Species:Mus musculus


Alignment Length:148 Identity:39/148 - (26%)
Similarity:67/148 - (45%) Gaps:43/148 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKD--- 69
            :|..:::..|.|::|.:|....|:|.|:..|:.:|::|||.|||||||.|.|||:|:|.|:.   
Mouse   406 QVAAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELV 470

  Fly    70 ------------------IELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIA 116
                              :|...:|..|...:|   :::|.|.....:.:::.:|          
Mouse   471 KLMCELGNVIINQIYEARVEAMAVKKPGPSCSR---QEKEAWIHAKYVEKKFLTK---------- 522

  Fly   117 TLAQGKSWDLKEAQGRVG 134
                     |.|.:||.|
Mouse   523 ---------LPEIRGRRG 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 34/126 (27%)
Acap1NP_722483.2 Required for formation of endosomal tubules when overexpressed with PIP5K1C. /evidence=ECO:0000250|UniProtKB:Q15027 1..382
BAR_ACAP1 18..217 CDD:153323
PH 266..360 CDD:278594
PH_ACAP 268..364 CDD:270070
Required for interaction with GULP1. /evidence=ECO:0000250|UniProtKB:Q15027 405..740 39/148 (26%)
ArfGap 406..519 CDD:279720 33/115 (29%)
Prevents interaction with ITGB1 when S-554 is not phosphorylated. /evidence=ECO:0000250 525..566 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..562 4/7 (57%)
Ank_2 575..670 CDD:289560
ANK repeat 575..602 CDD:293786
ANK <592..692 CDD:238125
ANK repeat 606..637 CDD:293786
ANK repeat 639..670 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.