DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Appl2

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_660255.1 Gene:Appl2 / 216190 MGIID:2384914 Length:662 Species:Mus musculus


Alignment Length:249 Identity:51/249 - (20%)
Similarity:86/249 - (34%) Gaps:66/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 GWSLFSTNASKLASTAKEKAVTTVNLA------STKIKEGTLL---DSVQCGVTDVASKVTD--- 294
            |..:||.:.....|:.|: .|.::.:.      ..::.:..||   :||.....|||:...:   
Mouse   214 GAEMFSKSMDGFLSSVKD-MVQSIQVELEAEADKMRVSQQELLSVSESVYTPDIDVATAQINRNL 277

  Fly   295 MGKRGWNNLAGSNISSPQGGYNDPNFEDSSAYQRSNSVGGNL--------AGGLGQQSGVSDSDW 351
            :.|.|:.||....      |.....:|....:.:    ||||        ||||.|.        
Mouse   278 IQKTGYLNLRNKT------GLVTTTWERLYFFTQ----GGNLMCQPRGAVAGGLIQD-------- 324

  Fly   352 GGWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFEATNYQSSETSYQNASSGGS 416
               .||.:..:.......|..|:|:.||    ..|:...|:           |...|:......:
Mouse   325 ---LDNCSVMAVDCEDRRYCFQISTPSG----KPGIILQAE-----------SRKEYEEWICAVN 371

  Fly   417 TARRNMKLQDTSQKLSEGFESLDVKSVKPKT-------ATASSAN--KGTAEDD 461
            ...|.:.|.|..:.::.......:::|.|.|       ::.||.|  ....|||
Mouse   372 NISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCSSQNIKNSDIEDD 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720
Appl2NP_660255.1 BAR_APPL2 20..234 CDD:153316 5/20 (25%)
BAR-PH_APPL 252..376 CDD:270067 33/159 (21%)
PH 278..378 CDD:278594 27/135 (20%)
PH domain 278..376 26/133 (20%)
PTB_APPL 480..613 CDD:269980
PTB domain 491..607
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 642..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.