Sequence 1: | NP_524040.2 | Gene: | ArfGAP1 / 39417 | FlyBaseID: | FBgn0020655 | Length: | 468 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848494.2 | Gene: | Arap2 / 212285 | MGIID: | 2684416 | Length: | 1703 | Species: | Mus musculus |
Alignment Length: | 208 | Identity: | 54/208 - (25%) |
---|---|---|---|
Similarity: | 81/208 - (38%) | Gaps: | 67/208 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 VLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDK--WKDIE 71
Fly 72 LEKMKAGGNRNAREF----LEDQEDWNERAP-------ITQRYNSK------------------- 106
Fly 107 -AAALYRDKIATLA---QGKSWDLKEAQG------------RVGS--------NNSFS------- 140
Fly 141 --SGGSSNSSYQS 151 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ArfGAP1 | NP_524040.2 | ArfGap | 7..114 | CDD:279720 | 37/137 (27%) |
Arap2 | NP_848494.2 | SAM_Arap1,2,3 | 6..68 | CDD:188889 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 84..132 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 191..232 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 286..319 | ||||
PH1_ARAP | 482..573 | CDD:270073 | |||
PH2_ARAP | 583..673 | CDD:270074 | |||
ArfGap_ARAP2 | 678..798 | CDD:350081 | 35/112 (31%) | ||
PH3_ARAP | 890..1000 | CDD:270076 | 1/1 (100%) | ||
PH-like | 1013..1108 | CDD:388408 | |||
RhoGAP_ARAP | 1112..1291 | CDD:239850 | |||
RA_ARAP2 | 1323..1420 | CDD:340747 | |||
PH-like | 1426..1537 | CDD:388408 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1633..1670 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1684..1703 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |