DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Asap2

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_006515110.1 Gene:Asap2 / 211914 MGIID:2685438 Length:1003 Species:Mus musculus


Alignment Length:137 Identity:48/137 - (35%)
Similarity:65/137 - (47%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
            |:.::.|::....|..|.:||..:|.|:|...||..|:||||.||.||||.|.::|:|:|.....
Mouse   423 TKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTS 487

  Fly    71 ELEKMKAGGNRNAREFLE---DQEDWNERAP----------ITQRYNSKAAALYRDKIATLAQGK 122
            ||...|..||....|.:|   ..||..:..|          ||.:|..:..|  |.|.|..| .|
Mouse   488 ELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYA--RKKHADTA-AK 549

  Fly   123 SWDLKEA 129
            ...|.||
Mouse   550 LHSLCEA 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 40/119 (34%)
Asap2XP_006515110.1 BAR_ASAP2 34..248 CDD:153326
PH_ASAP 300..406 CDD:270071
ArfGap_ASAP2 422..544 CDD:350074 42/122 (34%)
ANK repeat 553..585 CDD:293786 3/4 (75%)
ANK repeat 589..621 CDD:293786
Ank_2 592..676 CDD:372319
ANK repeat 623..654 CDD:293786
SH3_ASAP2 945..1000 CDD:212899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.