DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and git-1

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_509761.2 Gene:git-1 / 181253 WormBaseID:WBGene00008805 Length:670 Species:Caenorhabditis elegans


Alignment Length:122 Identity:30/122 - (24%)
Similarity:49/122 - (40%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEKMKAGGNRN 82
            |..:|.:||....:|.||..|..||.||...|..||..:|::|.:....|.:..:..:.|....|
 Worm    14 EQKECDDCGKKEVEWASVKKGTVICSECFCFHSYLGPSVSYLRHLRKSAWDEEHIRLVHALNTSN 78

  Fly    83 AREFLED---QEDWNERAPITQRYNSKAAALYRDKIATLA----QGKSWDLKEAQGR 132
            .....|.   :.....:.|:.|..:.......::|...|.    :||..||:.:..|
 Worm    79 TNMIWESALYEGSTKFQKPMAQDPSHIKEQFVKEKYEKLTFQPKRGKDEDLENSLNR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 23/98 (23%)
git-1NP_509761.2 ArfGap 7..127 CDD:214518 27/112 (24%)
ANK <122..212 CDD:238125 5/14 (36%)
Ank_5 152..207 CDD:290568
ANK repeat 165..197 CDD:293786
GIT 264..294 CDD:128828
GIT 326..356 CDD:128828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.