DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and F07F6.8

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001379858.1 Gene:F07F6.8 / 173926 WormBaseID:WBGene00017220 Length:318 Species:Caenorhabditis elegans


Alignment Length:281 Identity:55/281 - (19%)
Similarity:97/281 - (34%) Gaps:97/281 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 PKTQSQELFDSTLST--LASGWSLFSTN-----------ASKLASTAKEKAVTTVNLASTKIKEG 275
            |::.|:||.::.|.|  |...|   |.|           |.||.:..|..|::|...::..|..|
 Worm    32 PRSMSKELSETALRTQFLLDKW---SNNRRKIVRQMEGIAEKLDNWEKGCAISTAVGSTVGIASG 93

  Fly   276 T----------------LLDSVQCGVTDVASKVTD-MGKRGWNNLAGSNISSPQGG--------- 314
            .                |:.....||:::|:.:|. ...:|.:....:.|:  :.|         
 Worm    94 IAVIGGLILMPPVAIAGLIVGTASGVSNLATGITKFFHTKGQHKEVAAMIA--EDGVLFEELLKS 156

  Fly   315 -----------YNDPNF-----EDSSAYQRSNSV-GGNLAG--GLGQQSGVSDSDWGGWQDNGNS 360
                       ..|..|     .|.....:..:| ||::.|  |:|.:..::..           
 Worm   157 REELMEAVRKIVEDEEFFKHFKNDGDIENKLKTVFGGSVTGITGIGTRFAITSM----------- 210

  Fly   361 KSHMTSSSSYHNQLSSSSGGG----TASAGLTRDADWSGFEATNYQSSETSYQNASS--GGSTAR 419
                       .:||||...|    .|..|:..|:      .|...|::|..:.:.|  |.|...
 Worm   211 -----------GRLSSSLVKGVLHSVAVIGIVLDS------VTLALSAKTLGEGSVSELGSSILE 258

  Fly   420 RNMKLQDTSQKLSEGFESLDV 440
            .:.|::...||:.:.|.:.||
 Worm   259 ASSKMEMMRQKVVKHFLNEDV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720
F07F6.8NP_001379858.1 ApoL <59..>126 CDD:398882 12/66 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.