DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Acap3

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_997106.1 Gene:Acap3 / 140500 MGIID:2153589 Length:833 Species:Mus musculus


Alignment Length:299 Identity:74/299 - (24%)
Similarity:115/299 - (38%) Gaps:94/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASPRT----------------RRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHR 50
            |||.|                ..|||.::....||:|.:||..:|:|.|:..|:.:|:||||.||
Mouse   382 ASPSTSSIDSTTDSRERGVKGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHR 446

  Fly    51 SLGVHLSFVRSVTMDKWKDIELEKMKAGGNRNAREFLE------------------DQEDWNE-- 95
            |||||.|.|||:|:|.|:...|:.|...||....:..|                  |:|.|.:  
Mouse   447 SLGVHCSKVRSLTLDSWEPELLKLMCELGNSTVNQIYEAQCEGPGVRKPTASSSRQDKEAWIKDK 511

  Fly    96 ----------------------RAPITQR-YNSKAAALYRDK---------IATLAQGKSWDLKE 128
                                  ||...|| ::|..|...|.|         :|.|:...:.:.|.
Mouse   512 YVEKKFLRKLTSAPAREPPRRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSAATMERKF 576

  Fly   129 AQ------GRVGSNNSFSSGGSSNSSYQSRPSATGYGGNGGYQN-----GGGA------EPGGYQ 176
            .:      ..:.|..|:...|::.:..:|..|.:|.||:....:     |.|:      |..|.:
Mouse   577 RRDSLFCPDELDSLFSYFDAGAAGAGPRSLSSDSGLGGSSDGSSDVLAFGTGSVVDSVTEEEGAE 641

  Fly   177 QYQTQEFKDQKEEFFSRRQV---------ENASRPENLP 206
            ..::....|.:.|.:|...|         ..|:|..:||
Mouse   642 SEESSSEVDGEAEAWSLADVRELHPGLLAHQAARTRDLP 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 46/149 (31%)
Acap3NP_997106.1 BAR_ACAP3 16..215 CDD:153321
PH 269..363 CDD:278594
PH_ACAP 271..367 CDD:270070
ArfGap 403..521 CDD:279720 39/117 (33%)
ANK 671..786 CDD:238125 4/10 (40%)
Ank_2 671..764 CDD:289560 4/10 (40%)
ANK repeat 700..731 CDD:293786
ANK repeat 733..764 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.