| Sequence 1: | NP_524040.2 | Gene: | ArfGAP1 / 39417 | FlyBaseID: | FBgn0020655 | Length: | 468 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006520455.1 | Gene: | Asap1 / 13196 | MGIID: | 1342335 | Length: | 1223 | Species: | Mus musculus |
| Alignment Length: | 139 | Identity: | 41/139 - (29%) |
|---|---|---|---|
| Similarity: | 66/139 - (47%) | Gaps: | 18/139 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 TRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
Fly 71 ELEKMKAGGNRNAREFLE-----------DQEDWNERAP------ITQRYNSKAAALYRDKIATL 118
Fly 119 AQG-KSWDL 126 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ArfGAP1 | NP_524040.2 | ArfGap | 7..114 | CDD:279720 | 34/123 (28%) |
| Asap1 | XP_006520455.1 | BAR_ASAP1 | 138..344 | CDD:153325 | |
| PH_ASAP | 407..513 | CDD:270071 | |||
| ArfGap_ASAP1 | 528..649 | CDD:350073 | 34/119 (29%) | ||
| ANK repeat | 692..725 | CDD:293786 | |||
| Ank_2 | 696..>768 | CDD:372319 | |||
| ANK repeat | 727..758 | CDD:293786 | |||
| Atrophin-1 | 845..>1109 | CDD:367360 | |||
| SH3_ASAP1 | 1165..1221 | CDD:212898 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||