DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and AGAP3

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_114152.3 Gene:AGAP3 / 116988 HGNCID:16923 Length:911 Species:Homo sapiens


Alignment Length:159 Identity:46/159 - (28%)
Similarity:62/159 - (38%) Gaps:42/159 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEK 74
            :|.::....||.|.:|...||.|.|:..|..:|:||||.||.||.|||.|||:.:|.|....|..
Human   665 VQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAV 729

  Fly    75 MKAGGNRNAREF----------------LEDQEDWNERAPITQRYNSK----------------- 106
            |.|.||..|...                .|::|.|     |..:|..|                 
Human   730 MTAMGNALANSVWEGALGGYSKPGPDACREEKERW-----IRAKYEQKLFLAPLPSSDVPLGQQL 789

  Fly   107 AAALYRDK----IATLAQGKSWDLKEAQG 131
            ..|:..|.    :..||.|...::.|..|
Human   790 LRAVVEDDLRLLVMLLAHGSKEEVNETYG 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 40/136 (29%)
AGAP3NP_114152.3 small_GTPase 126..291 CDD:197466
Centaurin_gamma 128..285 CDD:133303
PH_AGAP 401..645 CDD:241281
PH 404..>465 CDD:278594
ArfGap 664..778 CDD:279720 39/117 (33%)
Ank_2 789..879 CDD:289560 7/30 (23%)
ANK 789..>878 CDD:238125 7/30 (23%)
ANK repeat 789..819 CDD:293786 7/30 (23%)
ANK repeat 821..852 CDD:293786
ANK repeat 854..879 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.