DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ArfGAP1 and AGAP2

DIOPT Version :9

Sequence 1:	NP_524040.2	Gene:	ArfGAP1 / 39417	FlyBaseID:	FBgn0020655	Length:	468	Species:	Drosophila melanogaster
Sequence 2:	NP_001116244.1	Gene:	AGAP2 / 116986	HGNCID:	16921	Length:	1192	Species:	Homo sapiens

Alignment Length:	141	Identity:	45/141 - (31%)
Similarity:	67/141 - (47%)	Gaps:	29/141 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 LQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKW-KDIELE 73
            :|.::....||.|.:||..||.|.|:..|..||:||||.||:||.|||.|||:.:|.| :::.|
Human   934 IQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTL- 997

  Fly    74 KMKAGGNRNAREF----------------LEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ-- 120
            .:.|.||..|...                .|::|.|     |..:|..   .|:...::|..:
Human   998 VLTAIGNDTANRVWESDTRGRAKPSRDSSREERESW-----IRAKYEQ---LLFLAPLSTSEEPL 1054

  Fly   121 GKS-WDLKEAQ 130
            |:. |...:||
Human  1055 GRQLWAAVQAQ 1065

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ArfGAP1	NP_524040.2	ArfGap	7..114	CDD:279720	40/120 (33%)
AGAP2	NP_001116244.1	Interaction with EPB41L1. /evidence=ECO:0000250	1..23
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	24..377
		Interactions with HOMER1 and NF2. /evidence=ECO:0000250	180..225
		Interaction with PLCG1. /evidence=ECO:0000250	267..390
		G domain	405..572
		small_GTPase	405..572	CDD:197466
		Centaurin_gamma	407..566	CDD:133303
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	582..619
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	634..673
		PH_AGAP	674..914	CDD:241281
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	769..854
		PH	<845..909	CDD:278594
		ArfGap	933..1047	CDD:279720	40/121 (33%)
		Ank_2	1058..1148	CDD:289560	3/8 (38%)
		ANK	1058..>1147	CDD:238125	3/8 (38%)
		ANK repeat	1058..1088	CDD:293786	3/8 (38%)
		ANK repeat	1090..1121	CDD:293786
		ANK 1	1090..1119
		ANK 2	1123..1152
		ANK repeat	1123..1148	CDD:293786
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1153..1192
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5347
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.810