DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and Arap3

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_006525549.1 Gene:Arap3 / 106952 MGIID:2147274 Length:1539 Species:Mus musculus


Alignment Length:80 Identity:25/80 - (31%)
Similarity:42/80 - (52%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDK--WKDIE 71
            |.:::.....|..|.:|....|.|.:|..|:.||.:|:|:||:||..:|.|:|:.:|.  |.:..
Mouse   487 VAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEI 551

  Fly    72 LEKMKAGGNRNAREF 86
            ::.....||..|..|
Mouse   552 VQLFIVLGNDRANCF 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 25/80 (31%)
Arap3XP_006525549.1 SAM_Arap1,2,3 4..66 CDD:188889
PHA03247 <81..312 CDD:223021
PH1_ARAP 285..377 CDD:270073
PH2_ARAP 392..475 CDD:270074
ArfGap_ARAP3 485..600 CDD:350089 25/80 (31%)
PH-like 671..783 CDD:388408
PH-like 798..891 CDD:388408
RhoGAP_ARAP 906..1081 CDD:239850
Ubiquitin_like_fold 1113..1210 CDD:391949
PH5_ARAP 1210..1326 CDD:270079
PLN02983 <1472..>1538 CDD:215533
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.