DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ArfGAP1 and agap2

DIOPT Version :9

Sequence 1:	NP_524040.2	Gene:	ArfGAP1 / 39417	FlyBaseID:	FBgn0020655	Length:	468	Species:	Drosophila melanogaster
Sequence 2:	XP_002933734.3	Gene:	agap2 / 100496997	XenbaseID:	XB-GENE-1011294	Length:	2037	Species:	Xenopus tropicalis

Alignment Length:	110	Identity:	41/110 - (37%)
Similarity:	54/110 - (49%)	Gaps:	19/110 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 LQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEK 74
            :|.::....||.|.:||..||.|.|:..|..||:||||.||:||.|||.|||:.:|.| .:||..
Frog  1791 IQAIRNAKGNSFCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDW-PLELTL 1854

  Fly    75 MKAG-GNRNAREF----------------LEDQEDWNERAPITQR 102
            :... ||..|...                .|::|.| .||...||
Frog  1855 VLTSIGNEMANSIWEMTTHGRTKPAPDSSREERESW-IRAKYEQR 1898

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ArfGAP1	NP_524040.2	ArfGap	7..114	CDD:279720	41/110 (37%)
agap2	XP_002933734.3	PHA03247	<111..662	CDD:223021
		PHA03247	<470..878	CDD:223021
		Centaurin_gamma	1297..1454	CDD:133303
		PH_AGAP	1559..1771	CDD:241281
		ArfGap_AGAP	1789..1896	CDD:350065	39/106 (37%)
		Ank_2	1915..2005	CDD:403870
		ANK repeat	1915..1945	CDD:293786
		ANK repeat	1947..1978	CDD:293786
		ANK repeat	1980..2005	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910