DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and asap2

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002935078.3 Gene:asap2 / 100494274 XenbaseID:XB-GENE-1002636 Length:1025 Species:Xenopus tropicalis


Alignment Length:156 Identity:49/156 - (31%)
Similarity:70/156 - (44%) Gaps:34/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
            |:.::.:::....|..|.:||..:|.|:|...||..|:||||.||.||||.|.::|:|:|.....
 Frog   420 TKEIISDIQRMPGNDVCCDCGASDPTWLSTNLGILTCIECSGIHRELGVHYSRIQSLTLDVLGTS 484

  Fly    71 ELEKMKAGGNRNAREFLE------DQ------EDWN-----------ERAPITQRYNSKAAALY- 111
            ||...|..||....|.:|      |.      .|.|           ||....::|:..|:.|: 
 Frog   485 ELLLAKNIGNSGFNELMEACLPADDSVKPSPCSDMNARKDYITTKYIERKYARRKYHDNASKLHG 549

  Fly   112 -------RDKIATLAQ--GKSWDLKE 128
                   || |.||.|  .:..||.|
 Frog   550 LCDAVKSRD-IFTLVQLHAEGVDLTE 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 40/137 (29%)
asap2XP_002935078.3 BAR_ASAP2 34..248 CDD:153326
PH_ASAP 297..403 CDD:270071
ArfGap_ASAP2 419..541 CDD:350074 37/120 (31%)
ANKYR 498..676 CDD:223738 19/78 (24%)
ANK repeat 550..582 CDD:293786 9/26 (35%)
ANK repeat 585..618 CDD:293786
ANK repeat 620..651 CDD:293786
PHA02682 <902..>980 CDD:177464
SH3_ASAP2 967..1022 CDD:212899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.