DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and asap1

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_031759002.1 Gene:asap1 / 100036721 XenbaseID:XB-GENE-1013472 Length:1136 Species:Xenopus tropicalis


Alignment Length:139 Identity:38/139 - (27%)
Similarity:70/139 - (50%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDI 70
            |:.::.:::....|..|.:||:.:|.|:|...||..|:||||.||.:|||:|.::|:.:||....
 Frog   441 TKAIIDDVQKTPGNEVCCDCGSPDPTWLSTNLGILTCIECSGIHREMGVHISRIQSLELDKLGTS 505

  Fly    71 ELEKMKAGGNRNAREFLED-----------------QEDWNERAPITQRYNSKAAALYRDKIATL 118
            ||...|..||.:..:.:|.                 ::::.....:.:|::.|..:...:|:..|
 Frog   506 ELLLAKNVGNNSFNDIMEGNLLSPSAKPSPSSDMIARKEYITAKYVERRFSRKICSTGAEKLNEL 570

  Fly   119 AQG-KSWDL 126
            .:. ||.||
 Frog   571 LEAVKSRDL 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 31/123 (25%)
asap1XP_031759002.1 BAR_ASAP1 54..268 CDD:153325
PH_ASAP 319..425 CDD:270071
ArfGap_ASAP1 440..561 CDD:350073 32/119 (27%)
Ank_2 585..660 CDD:403870
ANK repeat 604..637 CDD:293786
ANK repeat 639..670 CDD:293786
PHA03247 <735..1052 CDD:223021
SH3_ASAP1 1078..1134 CDD:212898
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.