DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP1 and appl2

DIOPT Version :9

Sequence 1:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001121547.1 Gene:appl2 / 100000135 ZFINID:ZDB-GENE-081016-2 Length:662 Species:Danio rerio


Alignment Length:102 Identity:19/102 - (18%)
Similarity:35/102 - (34%) Gaps:22/102 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 GTASAGLTRDADWSGFEATNYQSSETSYQNASSGGSTA---------------------RRNMKL 424
            |..:.|:..|.|.|...|.:.:.....:|..|..|.|:                     .|.:.|
Zfish   314 GAVAGGMVLDLDNSSVMAVDCEDRRYCFQITSPNGKTSLILQAESKREYEEWICTLNNISRQIYL 378

  Fly   425 QDTSQKLSEGFESLDVKSVKPKTATASSANKGTAEDD 461
            .|..:.::.......:::|.|.|:....| :|:...|
Zfish   379 TDNPEAVAIKLHQTALQAVTPITSFEKRA-EGSPNPD 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720
appl2NP_001121547.1 BAR 21..235 CDD:299863
BAR-PH_APPL 253..375 CDD:270067 10/60 (17%)
PH 277..377 CDD:278594 11/62 (18%)
PTB_APPL 488..614 CDD:269980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.