DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CALN1

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_113656.2 Gene:CALN1 / 83698 HGNCID:13248 Length:261 Species:Homo sapiens


Alignment Length:156 Identity:43/156 - (27%)
Similarity:66/156 - (42%) Gaps:35/156 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ASSGSILPTEIPIEDEERLERIFNKLDRDGDGRIDIHDLSAALHEFGL--SSVYAEKFLQQSDKD 161
            |.|.|.....|.:|:.:.:...|..|||||:|.|...:|..|:...|.  |.|.....:|:.|.|
Human    65 AGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMD 129

  Fly   162 QSGNVGFAEFLHYVREHEKNLVLQFSHLDKNRDG----------------KVDLEE----LISAF 206
            ..|.|.|.||:..:   ...||     ..:.|||                ::.|||    |..||
Human   130 GDGQVDFDEFMTIL---GPKLV-----SSEGRDGFLGNTIDSIFWQFDMQRITLEELKHILYHAF 186

  Fly   207 KDLGLDIDMDEARNLLTRMDKDGSLN 232
            :|   .:.|.:..|::  ::::.|||
Human   187 RD---HLTMKDIENII--INEEESLN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 42/155 (27%)
EFh 116..176 CDD:238008 21/61 (34%)
EFh 186..242 CDD:238008 15/67 (22%)
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578
Mito_carr 470..581 CDD:278578
CALN1NP_113656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
PTZ00184 74..>184 CDD:185504 32/117 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.