DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CDPK9

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_197748.1 Gene:CDPK9 / 832424 AraportID:AT5G23580 Length:490 Species:Arabidopsis thaliana


Alignment Length:138 Identity:43/138 - (31%)
Similarity:75/138 - (54%) Gaps:13/138 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IEDEE--RLERIFNKLDRDGDGRIDIHDLSAALHEFGLSSVYAE--KFLQQSDKDQSGNVGFAEF 171
            :.:||  .|:.:|..:|.|..|.|...:|..::...|...:.:|  :.|:.:|.|:||.:.:.||
plant   320 LSEEEIGGLKELFKMIDTDKSGTITFEELKDSMRRVGSELMESEIQELLRAADVDESGTIDYGEF 384

  Fly   172 L----HYVR-EHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGL-DIDMDEARNLLTRMDKDGS 230
            |    |..: |.|:|||..||..||:..|.:.:|||..|:|:.|: |.::||   ::..:|:|..
plant   385 LAATIHLNKLEREENLVAAFSFFDKDASGYITIEELQQAWKEFGINDSNLDE---MIKDIDQDND 446

  Fly   231 LNISFNEW 238
            ..|.:.|:
plant   447 GQIDYGEF 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 43/138 (31%)
EFh 116..176 CDD:238008 18/65 (28%)
EFh 186..242 CDD:238008 18/54 (33%)
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578
Mito_carr 470..581 CDD:278578
CDPK9NP_197748.1 STKc_CAMK 21..279 CDD:270687
Pkinase 22..280 CDD:278497
PTZ00184 316..458 CDD:185504 43/138 (31%)
EFh 328..387 CDD:238008 17/58 (29%)
EFh 400..459 CDD:238008 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.