DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CPK17

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_196779.1 Gene:CPK17 / 831091 AraportID:AT5G12180 Length:528 Species:Arabidopsis thaliana


Alignment Length:137 Identity:37/137 - (27%)
Similarity:74/137 - (54%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IEDEE--RLERIFNKLDRDGDGRIDIHDLSAALHEFG--LSSVYAEKFLQQSDKDQSGNVGFAEF 171
            :.:||  .|:.:|..:|.|..|.|.:.:|...|.:.|  ||....::.::.:|.|.:|.:.:.||
plant   371 LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADGNGTIDYGEF 435

  Fly   172 ----LHYVR-EHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGLDIDMDEARNLLTRMDKDGSL 231
                :|..| :.|::|...|.|.||:..|.:.:|||..|.::.|:: |..:.:.:::.:|.|...
plant   436 IAATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQALREFGMN-DGRDIKEIISEVDGDNDG 499

  Fly   232 NISFNEW 238
            .|:::|:
plant   500 RINYDEF 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 37/137 (27%)
EFh 116..176 CDD:238008 17/65 (26%)
EFh 186..242 CDD:238008 15/53 (28%)
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578
Mito_carr 470..581 CDD:278578
CPK17NP_196779.1 STKc_CAMK 73..330 CDD:270687
PTZ00184 371..510 CDD:185504 37/137 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.