DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CPK1

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_196107.1 Gene:CPK1 / 830366 AraportID:AT5G04870 Length:610 Species:Arabidopsis thaliana


Alignment Length:143 Identity:41/143 - (28%)
Similarity:74/143 - (51%) Gaps:11/143 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ILPTEIPIEDEERLERIFNKLDRDGDGRIDIHDLSAALHEFGLSSVYAE--KFLQQSDKDQSGNV 166
            ::...:..|:...|:.:||.:|.|..|:|...:|.|.|...|.:...:|  ..:|.:|.|.||.:
plant   443 VIAESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNSGTI 507

  Fly   167 GFAEF----LHYVR-EHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGL-DIDMDEARNLLTRM 225
            .:.||    ||..: |.|.:|...|::.||:..|.:..:||..|.::.|: |:.::|   |:..:
plant   508 DYKEFIAATLHLNKIEREDHLFAAFTYFDKDGSGYITPDELQQACEEFGVEDVRIEE---LMRDV 569

  Fly   226 DKDGSLNISFNEW 238
            |:|....|.:||:
plant   570 DQDNDGRIDYNEF 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 41/143 (29%)
EFh 116..176 CDD:238008 21/65 (32%)
EFh 186..242 CDD:238008 16/54 (30%)
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578
Mito_carr 470..581 CDD:278578
CPK1NP_196107.1 STKc_CAMK 149..407 CDD:270687
PTZ00184 444..586 CDD:185504 41/142 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.