DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and AT4G27790

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_194508.1 Gene:AT4G27790 / 828892 AraportID:AT4G27790 Length:345 Species:Arabidopsis thaliana


Alignment Length:181 Identity:40/181 - (22%)
Similarity:78/181 - (43%) Gaps:42/181 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RLERIFNKLDRD-GDGRIDIHDLSA-ALHEFGLSSVY-AEKFLQQSDKDQSGNVGFAEFL----- 172
            |::.:|..||.. .||.:.:.:|.. .:.:...:.|| ..|.|:..|||:.|.:.|.|:|     
plant    95 RIKFLFPLLDASPRDGFVSLKELQTWMMQQTEDNMVYRTAKELELQDKDKDGVITFEEYLPQFSK 159

  Fly   173 HYVREHEKN------LVLQFSHLDKNRDGKVDLEELISAFKDLGLDIDMDEARN----------L 221
            ..:.::||.      .:.||.:.|.:.:|.:|:||    |.:.   :..:::||          .
plant   160 QDIEKNEKGHGEAGWWMEQFKNSDFDHNGSLDIEE----FNNF---LHPEDSRNGDTQRWVLKER 217

  Fly   222 LTRMDKDGSLNISFNEWRDFMLLAPSTDIHDLIKFWRHSTYLDIGEDMNVP 272
            :|.||.:|...:.:.|:           :.:..:.::.....:..||.|||
plant   218 MTGMDTNGDGKLEYKEF-----------VKNAYEMYKEFAKFEKEEDENVP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 35/154 (23%)
EFh 116..176 CDD:238008 18/67 (27%)
EFh 186..242 CDD:238008 14/65 (22%)
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578
Mito_carr 470..581 CDD:278578
AT4G27790NP_194508.1 EFh_CREC 95..325 CDD:330175 40/181 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.