DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CPK15

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001190794.1 Gene:CPK15 / 828283 AraportID:AT4G21940 Length:561 Species:Arabidopsis thaliana


Alignment Length:246 Identity:50/246 - (20%)
Similarity:98/246 - (39%) Gaps:59/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LTPDPASNFNFAQQAQANYSARTLAASYEHGQNLGLQHAHLATSSTTNTPL-------------A 92
            ||.||....:.||                     .|:|..:......:.|:             .
plant   341 LTKDPKQRISAAQ---------------------ALEHPWIRGGEAPDKPIDSAVLSRMKQFRAM 384

  Fly    93 YDLHEVASSGSILPTEIPIEDEERLERIFNKLDRDGDGRIDIHDLSAALHEFG--LSSVYAEKFL 155
            ..|.::|.  .::...:..|:.:.|:.:|..:|.|..|.|...:|...|.:.|  |:....::.:
plant   385 NKLKKLAL--KVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKNGLAKLGSKLTEAEVKQLM 447

  Fly   156 QQSDKDQSGNVGFAEFL-----HYVREHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGLDIDM 215
            :.:|.|.:|.:.:.||:     .|..:.::::...|.:.||:..|.:.::||.||.|:.|:.   
plant   448 EAADVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMG--- 509

  Fly   216 DEA--RNLLTRMDKDGSLNISFNEWRDFM-----------LLAPSTDIHDL 253
            |||  :.::..:|.|....|::.|:...|           :|.|...:.||
plant   510 DEASIKEVIAEVDTDNDGRINYEEFCAMMRSGITLPQQGKILPPCKRVADL 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 36/166 (22%)
EFh 116..176 CDD:238008 16/66 (24%)
EFh 186..242 CDD:238008 17/57 (30%)
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578
Mito_carr 470..581 CDD:278578
CPK15NP_001190794.1 S_TKc 102..360 CDD:214567 8/39 (21%)
STKc_CAMK 102..359 CDD:270687 8/38 (21%)
PTZ00184 395..540 CDD:185504 35/147 (24%)
EFh 407..466 CDD:238008 15/58 (26%)
EFh 478..539 CDD:238008 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.