DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CPK21

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001319867.1 Gene:CPK21 / 825807 AraportID:AT4G04720 Length:531 Species:Arabidopsis thaliana


Alignment Length:144 Identity:37/144 - (25%)
Similarity:72/144 - (50%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 ILPTEIPIEDEERLERIFNKLDRDGDGRIDIHDLSAALHEFG--LSSVYAEKFLQQSDKDQSGNV 166
            ::...:..|:.:.|:.:|..:|.|..|.|...:|...|...|  ||....::.::.:|.|.:|.:
plant   372 VIAESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVDGNGTI 436

  Fly   167 GFAEFL-----HYVREHEKNLVLQFSHLDKNRDGKVDLEELISAFKDLGLDIDMDEA--RNLLTR 224
            .:.||:     .|..:.::::...|.|.||:..|.:..:||.||.|:.|:.   |||  :.:::.
plant   437 DYYEFISATMHRYKLDRDEHVYKAFQHFDKDNSGHITRDELESAMKEYGMG---DEASIKEVISE 498

  Fly   225 MDKDGSLNISFNEW 238
            :|.|....|:|.|:
plant   499 VDTDNDGRINFEEF 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 37/144 (26%)
EFh 116..176 CDD:238008 17/66 (26%)
EFh 186..242 CDD:238008 19/55 (35%)
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578
Mito_carr 470..581 CDD:278578
CPK21NP_001319867.1 STKc_CAMK 79..337 CDD:270687
PTZ00184 373..518 CDD:185504 37/143 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.