DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Slc25a42

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_006253013.1 Gene:Slc25a42 / 689414 RGDID:1592346 Length:329 Species:Rattus norvegicus


Alignment Length:219 Identity:69/219 - (31%)
Similarity:121/219 - (55%) Gaps:22/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 LVAGGIAGAVSRTCTAPLDRIKVYLQVQTQRMGISECMHIM----LNEGGSRSMWRGNGINVLKI 349
            |::|.:|||:::|..|||||.|:..||.::|....|...::    ||| |..|:||||...::::
  Rat    82 LLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRLLYFTYLNE-GFLSLWRGNSATMVRV 145

  Fly   350 APETAFKFAAYEQMKRLIRGDDGSRQMSIV--ERFYAGAAAGGISQTIIYPMEVLKTRLALRRTG 412
            .|..|.:|:|:|:.||::....|.|..::.  .|..|||.||..:.::.||:::::.|:|:....
  Rat   146 IPYAAIQFSAHEEYKRILGHYY
GFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKE 210

  Fly   413 QYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRY-----IANHD----- 467
            .|:.|....::|.::||:::.|.|:.|.:||::||||:....||:||..:     :.|.|     
  Rat   211 MYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHRGDPGLRNTDFRTGE 275

  Fly   468 -----NNEQPSFLVLLACGSTSST 486
                 .:.|....:||.|.....|
  Rat   276 RYGDATSGQRGISLLLPCALPPGT 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 32/84 (38%)
Mito_carr 375..463 CDD:278578 28/94 (30%)
Mito_carr 470..581 CDD:278578 5/17 (29%)
Slc25a42XP_006253013.1 Mito_carr 74..167 CDD:278578 32/85 (38%)
Mito_carr <192..259 CDD:278578 22/66 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.