DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG7943

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:185 Identity:46/185 - (24%)
Similarity:75/185 - (40%) Gaps:23/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 LVAGGIAGAVSRTCTAPLDRIKVYL---QVQTQRMGISECMHIMLNEGGSRSMWRG-------NG 343
            ::|..:||: :.:...|.:|::..|   :..............:::..|.|.::||       ||
  Fly   145 VLAAVVAGS-AESILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNG 208

  Fly   344 INVLKIAPETAFKFAAYEQMK-RLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLA 407
            ::       .|..|...|:.. ||.:....|.:  .|:.|.|||..|....||.||:.|:|..|.
  Fly   209 LS-------NALFFVLREEASVRLPKRK
SVSTR--TVQEFIAGAVIGASISTIFYPLNVIKVSLQ 264

  Fly   408 LRRTGQYAGIADAAVKIY--KQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKR 460
            .....:..|...|..:||  :...:.:||||...|........||....||.||:
  Fly   265 SEMGQRSEGSWQACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 17/91 (19%)
Mito_carr 375..463 CDD:278578 28/88 (32%)
Mito_carr 470..581 CDD:278578
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578
Mito_carr 141..229 CDD:278578 17/91 (19%)
Mito_carr 235..322 CDD:278578 28/85 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.