DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG1907

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:312 Identity:74/312 - (23%)
Similarity:129/312 - (41%) Gaps:41/312 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GGIAGAVSRTCTAPLDRIKVYLQVQTQRMGISE------CMHIMLNEGGSRSMWRGNGINVLKIA 350
            ||::|..:.....|||.:|..:|:.....|..|      |:..::::.|..::::|.|..:|:.|
  Fly    24 GGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQA 88

  Fly   351 PETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRL--------A 407
            ..|..:...|..:..|.| :...|...|.:....|..||.....|..|.||...|:        |
  Fly    89 TYTTGRLGMYTYLNDLFR-EKF
QRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVA 152

  Fly   408 LRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQP 472
            .||  .|..:|:|..:|.::||:.:.:||.:|.:...:......||.|...|..:  .|...:..
  Fly   153 ERR--NYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYF--RH
GPLQME 213

  Fly   473 SFLVLLACGS-TSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGL 536
            ..:.|..|.| .|..|..:.|.||.:.:||:|                .:|..|..........:
  Fly   214 EGIKLHFCASMLSGLLTTITSMPLDIAKTRIQ----------------NMKMVDGKPEYRGTADV 262

  Fly   537 FRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYE-----YTSRALGIKMS 583
            ..::.||||:..|::|.||.:.::.|...:::::.|     |....||...|
  Fly   263 LLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGSNKS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 20/83 (24%)
Mito_carr 375..463 CDD:278578 25/95 (26%)
Mito_carr 470..581 CDD:278578 26/116 (22%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 20/85 (24%)
Mito_carr 118..207 CDD:278578 24/92 (26%)
Mito_carr 219..307 CDD:278578 23/103 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.