DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG4743

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:292 Identity:74/292 - (25%)
Similarity:130/292 - (44%) Gaps:32/292 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 LVAGGIAGAVSRTCTAPLDRIKVYLQVQTQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPET 353
            |||||:||.|......|:|.:|..||   ..:|       ....||.|.:::|........||..
  Fly    31 LVAGGVAGMVVDIALFPIDTVKTRLQ---SELG-------FWRAGGFRGIYKGLAPAAAGSAPTA 85

  Fly   354 AFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIA 418
            |..|..||..|:.:.....::....| ...|.:||..::..|..|:|:.|.|....:..:.:|: 
  Fly    86 ALFFCTYECGKQFLSSVTQTKDSPYV-HMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGL- 148

  Fly   419 DAAVKIYKQEGV-RSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGS 482
            ...::.|:.||: |..|||:...|:..:|::.|...::|..|.::......:..| |.|.| ||:
  Fly   149 QILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTP-FSVAL-CGA 211

  Fly   483 TSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLT 547
            .:..:....:.||.:|:||:.....|:: |::|            |....:.|::    .:.|.:
  Fly   212 VAGGISAGLTTPLDVVKTRIMLAERESL-NRRR------------SARRILHGIY----LERGFS 259

  Fly   548 GLYRGITPNFLKVLPAVSISYVVYEYTSRALG 579
            ||:.|..|..|.:....:..:..|:.|:|.||
  Fly   260 GLFAGFVPRVLWITLGGAFFFGFYDLTTRILG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 25/80 (31%)
Mito_carr 375..463 CDD:278578 22/88 (25%)
Mito_carr 470..581 CDD:278578 27/110 (25%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 25/77 (32%)
PTZ00168 25..281 CDD:185494 69/280 (25%)
Mito_carr 199..291 CDD:278578 25/110 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.