DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG5805

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:308 Identity:65/308 - (21%)
Similarity:117/308 - (37%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 RTCTAPLDRIKVYLQVQTQR---MGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYE 361
            |.|..||..||..||||.:.   .|:.:|...:....|...::||..|:.::|. ...|..:.||
  Fly    54 RCCLFPLTVIKTQLQVQHKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIV-SGVFYISTYE 117

  Fly   362 QMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAG---------- 416
            .::.::.......:|..:.   .|..|..:.||||.|.:|:.....:.....:||          
  Fly   118 GVRHVLND
LGAGHRMKALA---GGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGI 179

  Fly   417 -----------IADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYI------A 464
                       ..|...:|.:::|.|.|||||..:::..:|.:.:..|.|...:....      .
  Fly   180 KSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFRICPVWV 244

  Fly   465 NHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSG 529
            :|       ..:....||.......:.:.||.:||.|||....                      
  Fly   245 SH-------LFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRL---------------------- 280

  Fly   530 EETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVV-YEYTSR 576
             ::|:..||::.::|.|...::|::...:: ..|.|.|.:: ||...|
  Fly   281 -DSMSVAFRELWQEEKLNCFFKGLSARLVQ-SAAFSFSIILGYETIKR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 20/72 (28%)
Mito_carr 375..463 CDD:278578 23/108 (21%)
Mito_carr 470..581 CDD:278578 21/108 (19%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 20/71 (28%)
Mito_carr 132..238 CDD:395101 23/108 (21%)
Mito_carr 245..327 CDD:395101 22/113 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.