DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and GC2

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:330 Identity:77/330 - (23%)
Similarity:136/330 - (41%) Gaps:52/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 QKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQT-----QRM--GISECMHIMLNEGG 334
            ||:.|....:..::.||:||.:...|..|||.:|..||.||     :||  .|::|....:...|
  Fly    12 QKKPQKFNVFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCFRKTIASEG 76

  Fly   335 SRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPM 399
            ...|:||:.:|::.|.||.|.|..|.:..:..:..|||...:|  ....||..||.....:..||
  Fly    77 YFGMYRGSAVNIVLITPEKAIKLTANDFFRYHLASDDGVIPLS--RATLAGGLAGLFQIVVTTPM 139

  Fly   400 EVLKTRLALRRTGQYAGIADAA---VK----------IYKQEGVRSFYRGYVPNILGILPYAGID 451
            |:||  :.::..|:.|....||   ||          :.::.|:...|:|.....:..:.::.:.
  Fly   140 ELLK--IQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVY 202

  Fly   452 LAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRK 516
            ..:...:..:.....|.:.:..|...|..|..|.........|..:|:|||||            
  Fly   203 FPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQA------------ 255

  Fly   517 TQIPLKSSDAHSGEETMTGLF---RKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVY--EYTSR 576
                       .||:...|:.   .:.:::||::..::|.....:.:.|...|:.:.|  ....:
  Fly   256 -----------DGEKKFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEK 309

  Fly   577 ALGIK 581
            .|||:
  Fly   310 ILGIE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 28/91 (31%)
Mito_carr 375..463 CDD:278578 19/100 (19%)
Mito_carr 470..581 CDD:278578 22/115 (19%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 69/301 (23%)
Mito_carr 16..106 CDD:278578 29/89 (33%)
Mito_carr 123..203 CDD:278578 18/81 (22%)
Mito_carr 228..302 CDD:278578 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.