DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Dic4

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:310 Identity:67/310 - (21%)
Similarity:119/310 - (38%) Gaps:53/310 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 WWRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQTQRMGISECMHIMLNEGGSRSMWRGNGINVLKI 349
            ||    .||.|........||:|.:|.::|:|.|:..|...:..:.:..|....:.|....:|:.
  Fly    23 WW----FGGFASMCVAFAVAPIDIVKTHMQIQRQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQ 83

  Fly   350 APETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLAL------ 408
            ...|...|..|:..|::...|    :.|.:.:...|..||........|.:::..|:..      
  Fly    84 MTSTNIHFIVYDTGKKMEYVD----RDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPP 144

  Fly   409 --RRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQ 471
              ||  .|..:.|..::|.|:||.::.|:|....:..........:|.|:.:|.....|...|:.
  Fly   145 YKRR--NYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDG 207

  Fly   472 PSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGL 536
            .....|.:.|  :|.:....::||.:|||.:.                     ::..||      
  Fly   208 LPLHFLTSLG--TSIISSAITHPLDVVRTIMM---------------------NSRPGE------ 243

  Fly   537 FRKIVRQE------GLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 580
            ||.:.:..      |:.|.|||..|..::..||.::.:|:||......||
  Fly   244 FRTVFQASVHMMRFGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHFGI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 20/84 (24%)
Mito_carr 375..463 CDD:278578 19/95 (20%)
Mito_carr 470..581 CDD:278578 25/117 (21%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 63/296 (21%)
Mito_carr 26..100 CDD:278578 18/73 (25%)
Mito_carr 104..201 CDD:278578 20/102 (20%)
Mito_carr 211..292 CDD:278578 23/109 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.