DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG6893

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:301 Identity:66/301 - (21%)
Similarity:130/301 - (43%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 WWRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQTQRMGISECMHIMLNEGGSRSMWRGNGINVLKI 349
            ||    :||:|||:::..|||.|.|:..:.|..:..|::..:...:...|..|::.|....:|:.
  Fly    18 WW----SGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQ 78

  Fly   350 APETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRT--- 411
            ...|:.:|..||..|..:  ||.:   .::::....|.||.::..:..|||::.||:.:.|.   
  Fly    79 LTYTSMRFHLYEMGKEHL--DDPA---GLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPK 138

  Fly   412 ---GQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDL---AVYETLKRRYI----ANH 466
               ..|..:.|...::.::||....|.|.   .|..:..:.|.:   |.|:..|:.|.    ..|
  Fly   139 ETRWNYRNVFDGLYRVTREEGFTKLYSGC---FLSFMRSSLITISQNAAYDQAKQIYAEFFHMKH 200

  Fly   467 DNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEE 531
            ||    :.|.|::..:.:...|.:.. |:..:|.                    |:..|:.....
  Fly   201 DN----TLLHLISSVTAAFVCGPIIK-PIENLRY--------------------LRMVDSRRLIN 240

  Fly   532 TMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYE 572
            :::.:.|     .|..|.:||:.|..|:::|...|:::.:|
  Fly   241 SISYMMR-----FGSRGPFRGMVPYVLRMVPNTVITFLSFE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 23/84 (27%)
Mito_carr 375..463 CDD:278578 20/96 (21%)
Mito_carr 470..581 CDD:278578 17/103 (17%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 21/75 (28%)
Mito_carr 98..192 CDD:395101 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.