DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG7514

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:305 Identity:74/305 - (24%)
Similarity:130/305 - (42%) Gaps:51/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 VAGGIAGAVSRTCTAPLDRIKVYLQVQT---QRMGISECMHIMLNEGGSRSMWRGNGINVLKIAP 351
            :.||:||.:......|||.:|..:|:..   :.....:|:..:....|..:::.|....:::.|.
  Fly    17 INGGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQAT 81

  Fly   352 ETAFKFAAYEQMKRLIRGDDGSRQM-----SIVERFYAGAAAGGISQTIIYPMEVLKTRL----- 406
            .|..:...| ||:     .|..|:.     :::.....|..||........|.||...|:     
  Fly    82 YTTARMGFY-QME-----IDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNR 140

  Fly   407 ---ALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDN 468
               |.||  .|.|:.:|.|:|.|.|||.:.::|.:|.:...:....:.||.|..||..:      
  Fly   141 LPPAERR--NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF------ 197

  Fly   469 NEQPSFLVL-LACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEET 532
            :|..|.|.| :|....|..|..:.|.||.:.:||:|.|                |::: :.|  |
  Fly   198 SEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQ----------------KTAE-YKG--T 243

  Fly   533 MTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRA 577
            |..|. |:.:.||:..|::|.||...::.|....:::..|..::|
  Fly   244 MDVLM-KVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 17/82 (21%)
Mito_carr 375..463 CDD:278578 26/100 (26%)
Mito_carr 470..581 CDD:278578 29/109 (27%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 73/303 (24%)
Mito_carr 19..90 CDD:278578 14/70 (20%)
Mito_carr 104..201 CDD:278578 27/104 (26%)
Mito_carr 207..284 CDD:278578 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.