DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and PMP34

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:310 Identity:78/310 - (25%)
Similarity:142/310 - (45%) Gaps:35/310 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 HLVAGGIAGAVSRTCTAPLDRIKVYLQ------VQTQRMGISECMHIMLNEGGSRSMWRGNGINV 346
            |.|:|...|.::.:...|||.::..||      |::.|..|.|   |:|.| |.:|::||.|..:
  Fly    18 HAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKE---IVLGE-GFQSLYRGLGPVL 78

  Fly   347 LKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRT 411
            ..:.......|..:..:|.:..|...| |.|.::....|:.||.|:.....|..|:.|||.:|..
  Fly    79 QSLCISNFVYFYTFHALK
AVASGGSPS-QHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNV 142

  Fly   412 GQYAGIADAAVKIYK-----------QEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIAN 465
               ||.:|...|.||           :||:...:.|.:|::: ::....:...:||.|||. |..
  Fly   143 ---AGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLM-LVSNPALQFMMYEMLKRN-IMR 202

  Fly   466 HDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGE 530
            ....|..| |.....|:.:.....:.:|||.||:|:.:.::.|:.:.       |..|:.:....
  Fly   203 FTGGEMGS-LSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSK-------PSTSAGSTPRT 259

  Fly   531 ETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 580
            |:...|...|::.:|:.||:||:....|:.:...::.::.||..:..:|:
  Fly   260 ESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVGM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 23/87 (26%)
Mito_carr 375..463 CDD:278578 27/98 (28%)
Mito_carr 470..581 CDD:278578 25/111 (23%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 22/81 (27%)
Mito_carr 105..202 CDD:278578 29/102 (28%)
Mito_carr 214..303 CDD:278578 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.