DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Shawn

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:335 Identity:80/335 - (23%)
Similarity:130/335 - (38%) Gaps:66/335 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 VAGGIAGAVSRTC-TAPLDRIKVYLQVQTQRMGISECM--------HI----------------- 328
            ||....||:...| ..|||.||..||.|.|.:..::|.        ||                 
  Fly    43 VASACTGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAP 107

  Fly   329 -----------MLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLI---------RGD--- 370
                       :....|..|:|.|....::...|.|...|.||||.|...         |.|   
  Fly   108 RFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIA 172

  Fly   371 -DGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFY 434
             |....:..:....||.:...::.|.:.|:|:::|::..:|. .:|.:.....::.:.:||...:
  Fly   173 HDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRM-THAEMFGTIRQVVQSQGVLGLW 236

  Fly   435 RGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVR 499
            ||..|.||..:|::||....||.||..:     ...:|:|....|.|:.|.::....:.|..:|:
  Fly   237 RGLPPTILRDVPFSGIYWTCYEYLKSSF-----GVVEPTFSFSFAAGAISGSVAATITTPFDVVK 296

  Fly   500 TRLQAQAAET-IANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPA 563
            |..|.:..|. |.:.....|:..||         :......|.|..|:..::.|:.|...||.||
  Fly   297 THEQIEFGEKFIFSDNPPKQVATKS---------VAMRLASIYRMGGVPAIFSGLGPRLFKVAPA 352

  Fly   564 VSISYVVYEY 573
            .:|....:||
  Fly   353 CAIMISSFEY 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 30/125 (24%)
Mito_carr 375..463 CDD:278578 22/87 (25%)
Mito_carr 470..581 CDD:278578 26/105 (25%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 29/115 (25%)
Mito_carr 178..265 CDD:278578 22/92 (24%)
Mito_carr 268..371 CDD:278578 26/104 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.