DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Tyler

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:394 Identity:83/394 - (21%)
Similarity:146/394 - (37%) Gaps:113/394 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 KEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQ---TQRMGISECMHIMLN-------- 331
            |.||      .:|:..:.|.::.....||:.:|..:|.|   .||..:|:..::..|        
  Fly    44 KPMQ------QVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCR 102

  Fly   332 -------------------------------EGGSRSMWRGNGINVLKIAPETAFKFAAYEQ--- 362
                                           ..|...:|.|....::...|.|...|..||.   
  Fly   103 SSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKN 167

  Fly   363 ----------------MKRLIRGDDGSRQMSIVER----------------FYAGAAAGGISQTI 395
                            ||..:.|.||...:....|                :|...|:|..|:||
  Fly   168 SLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTI 232

  Fly   396 ----IYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYE 456
                |.|:|:::.::..... .||.:......:.:|.|:...:||:.|.::...|::|...||||
  Fly   233 VVTAITPIEMVRIKMQSEYM-TYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYE 296

  Fly   457 TLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETI----------- 510
            .:||.:...     :|:||.....|:.|..:....:.|..|:.|..|.:..:.:           
  Fly   297 AIKRAFSVT-----EPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGA 356

  Fly   511 -----ANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVV 570
                 |..:.||.   :|:.|:|....::.: |:|.|.:|:.|||.|:.|..|:|:||.:|....
  Fly   357 GTGTGAGARPKTP---QSAVANSRPSVLSRM-RQIYRLQGVRGLYVGVMPRMLRVVPACAIMIST 417

  Fly   571 YEYT 574
            :||:
  Fly   418 FEYS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 21/145 (14%)
Mito_carr 375..463 CDD:278578 25/107 (23%)
Mito_carr 470..581 CDD:278578 31/121 (26%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 22/132 (17%)
Mito_carr 216..302 CDD:278578 24/86 (28%)
Mito_carr 306..429 CDD:278578 31/120 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.