DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and sea

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:304 Identity:84/304 - (27%)
Similarity:136/304 - (44%) Gaps:40/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 QTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQTQRM-----GISECMHIMLNEGGSRSMWR 340
            |.||  :.:|||||.|.:....|.|.:.:|..||:..:..     ||.:|:...:.|.|...::|
  Fly    31 QVGL--KGIVAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYR 93

  Fly   341 GNGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTI--IYPMEVLK 403
            |..:.|....|::|.:|.|:|.:|.  ...|...|:|...:...|..| |:.:.|  :.|||.:|
  Fly    94 GLSVLVYGSIPKSAARFGAFEFLKS--NAVDSRGQLSNSGKLLCGLGA-GVCEAIVAVTPMETIK 155

  Fly   404 TR-LALRRTG--QYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIAN 465
            .: :..:|:|  ::.|.|....:|.|.||:...|:|..|.||.......|...|.|:||..|..:
  Fly   156 VKFINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGD 220

  Fly   466 HDNNEQPSFLVLL--ACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHS 528
            ......|..:|.:  |....:|..|   :.||.:|:||:|...|....|            .||.
  Fly   221 DHTKPVPKLVVGVFGAIAGAASVFG---NTPLDVVKTRMQGLEASKYKN------------TAHC 270

  Fly   529 GEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYE 572
            ..|        |::.||....|:|..|...:|...|:|::::|:
  Fly   271 AVE--------ILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 25/89 (28%)
Mito_carr 375..463 CDD:278578 28/92 (30%)
Mito_carr 470..581 CDD:278578 26/105 (25%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 81/295 (27%)
Mito_carr 34..117 CDD:278578 25/84 (30%)
Mito_carr 125..220 CDD:278578 29/95 (31%)
Mito_carr 235..314 CDD:278578 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.