DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Mpcp1

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:299 Identity:71/299 - (23%)
Similarity:124/299 - (41%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 GIAGAVS----RTCTAPLDRIKVYLQVQTQR-MGISECMHIMLNEGGSRSMWRGNGINVLKIAPE 352
            |:.|.:|    .|...|||.:|..|||...: ..:.....|.|.|.|.|.:.:|.....:..:.:
  Fly    79 GLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQ 143

  Fly   353 TAFKFAAYEQMKRLIRGDDGSRQMSIVER----FYAGAAAGGISQTIIYPMEVLKTRLALRRTGQ 413
            ...||..||..|: :.||....:.:.:.|    ..|.|:|...:...:.|||..|.:  ::.|..
  Fly   144 GLCKFGLYEVFKK-VYGD
AIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVK--IQTTPG 205

  Fly   414 YA-GIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYE---TLKRRYI-----ANHDNN 469
            :| .:.:|..|:..||||.:||:|.||..:..:||..:..|.:|   .|..:|:     |:....
  Fly   206 FAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKG 270

  Fly   470 EQPSFLVLLACGSTSSTLGQLCSYPLALVRTRL-QAQAAETIANQKRKTQIPLKSSDAHSGEETM 533
            ||  .:|..|.|..:.....:.|:|...|.::| ||:.|..:                       
  Fly   271 EQ--LVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASAL----------------------- 310

  Fly   534 TGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYE 572
                 .:.:|.|.:||:.|:.|..:.:....:..:.:|:
  Fly   311 -----DVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 22/81 (27%)
Mito_carr 375..463 CDD:278578 26/95 (27%)
Mito_carr 470..581 CDD:278578 19/104 (18%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 22/81 (27%)
Mito_carr <188..258 CDD:278578 22/71 (31%)
Mito_carr 273..350 CDD:278578 17/100 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.