DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG8323

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:231 Identity:63/231 - (27%)
Similarity:100/231 - (43%) Gaps:22/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LAPSTDIHDLIKFWRHSTYLDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDR 308
            |||:.....:|..:|.|.|.:..|...:.:...:.....||.|     |.|.|.|....::|...
  Fly    69 LAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLW-----GAIGGVVGCYFSSPFFL 128

  Fly   309 IKVYLQVQTQRM----------GISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQM 363
            ||..||.|..:.          .:::.:..:.:..|.|.:|||:...:.:.|..:..:.|.:.:.
  Fly   129 IKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKT 193

  Fly   364 KRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRL------ALRRTGQYAGIADAAV 422
            |.|:...|...|.:: ..|.||..||.|....|.|.:|:.|||      |..|...|.|..|..|
  Fly   194 KALLVQYDLVTQPTL-NSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFV 257

  Fly   423 KIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETL 458
            ||.:.|||...|:|:..|.|.|.|::.:.|..::.|
  Fly   258 KILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 2/2 (100%)
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 20/94 (21%)
Mito_carr 375..463 CDD:278578 32/90 (36%)
Mito_carr 470..581 CDD:278578
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 6/17 (35%)
PTZ00169 5..293 CDD:240302 62/229 (27%)
Mito_carr 101..200 CDD:278578 22/103 (21%)
Mito_carr 206..301 CDD:278578 31/89 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.