DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Dic3

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:308 Identity:83/308 - (26%)
Similarity:131/308 - (42%) Gaps:51/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 WWRHLVAGGIAGAVSRTCTAPLDRIKVYLQVQTQ--RMGISECMHIMLNEGGSRSMWRGNGINVL 347
            ||    .||:..|::.|.|.|:|.|||.||.|:|  |..:.|.:..:....|....:.|...:..
  Fly    12 WW----FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWF 72

  Fly   348 KIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRL------ 406
            :....|..:||.||..|..:.....|.:|::..  :|| ..|||   :..|.:|:..||      
  Fly    73 RQLTYTTTRFALYEAGKDYVDTQKVSSKMALAT--FAG-IVGGI---VGVPGDVVTVRLQNDVKL 131

  Fly   407 --ALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNI-LGILPYAGIDLAVYETLKRRY-IANHD 467
              ..||  .|..:.|...:|||:|||.|.:||.||.: ..:|...|.: |.|:.:|:.. ||...
  Fly   132 PEEKRR--NYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTN-AAYDQVKQMLKIATGA 193

  Fly   468 NNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTR-LQAQAAETIANQKRKTQIPLKSSDAHSGEE 531
            ....|   :..|..:.:..:..:.:.||.:::|. :.||..|                  .||  
  Fly   194 GEGVP---LHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGE------------------FSG-- 235

  Fly   532 TMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALG 579
             :.|.|....:| |....|:|..|..::|.|...|::|:||......|
  Fly   236 -IGGAFLSTAKQ-GPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 26/86 (30%)
Mito_carr 375..463 CDD:278578 30/97 (31%)
Mito_carr 470..581 CDD:278578 24/111 (22%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 79/293 (27%)
Mito_carr 15..91 CDD:278578 24/75 (32%)
Mito_carr 93..187 CDD:278578 31/102 (30%)
Mito_carr 200..281 CDD:278578 22/102 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.