DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG4995

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:305 Identity:76/305 - (24%)
Similarity:117/305 - (38%) Gaps:63/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 VAGGIAGAVSRTCTAPLDRIKVYLQVQTQR----MGISECMHIMLNEGGSRSMWRG-----NGIN 345
            |||.:.||.......|.|.:||:||....|    .|...|...::.......::||     .||.
  Fly    45 VAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIG 109

  Fly   346 VLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRR 410
            ::     .|..|..|..::||....:     |:...|:||:.||.....:..|||:.||||    
  Fly   110 LV-----NAIVFGVYGNVQRLSNDPN-----SLTSHFFAGSIAGVAQGFVCAPMELAKTRL---- 160

  Fly   411 TGQYAGIADAAVK----------IYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIAN 465
              |.:...|:.:|          |.|.||:|..::|....||..:|........:|.|.|:.   
  Fly   161 --QLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV--- 220

  Fly   466 HDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSG- 529
                |.|.....|..|..:.....|..||:.:|:|.:||.|..  ||.|            ::| 
  Fly   221 ----ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALG--ANAK------------YNGF 267

  Fly   530 -EETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEY 573
             :..|.|.     |.||....:||:....::..|..:..:.|..:
  Fly   268 IDCAMKGF-----RNEGPQYFFRGLNSTLIRAFPMNAACFFVVSW 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 23/88 (26%)
Mito_carr 375..463 CDD:278578 28/97 (29%)
Mito_carr 470..581 CDD:278578 25/106 (24%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 21/84 (25%)
PTZ00169 41..295 CDD:240302 74/291 (25%)
Mito_carr 128..218 CDD:278578 27/100 (27%)
Mito_carr 221..304 CDD:278578 24/101 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.