DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and CG9582

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:183 Identity:52/183 - (28%)
Similarity:81/183 - (44%) Gaps:34/183 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 RFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIA------DAAVKIYKQEGVRSFYRGYVP 439
            :|.||..:|.|.....:|::|:|||:.::....:.|..      ||.||||:.||:.|.::|.||
  Fly    16 QFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGIVP 80

  Fly   440 NILGILPYAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQA 504
            .|....|..|....:||:||..:   .....||:.|.....||.::.|......|..:|:...| 
  Fly    81 PICVETPKRGGKFLMYESLKPYF---QFGAPQPTPLTHAMSGSMAAILESFLVNPFEVVKITQQ- 141

  Fly   505 QAAETIANQKRKTQIPLKSSDAHSGEETMT-GLFRKIVRQE--GLTGLYRGIT 554
                                 ||.|:...| .:.:.|::.:  |:.|||||||
  Fly   142 ---------------------AHRGKRLKTLSVVKYIIKHDGYGIKGLYRGIT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578
Mito_carr 375..463 CDD:278578 30/87 (34%)
Mito_carr 470..581 CDD:278578 22/88 (25%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 52/182 (29%)
Mito_carr 17..104 CDD:278578 30/89 (34%)
Mito_carr 109..196 CDD:278578 22/87 (25%)
Mito_carr 216..295 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.