DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and MME1

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:307 Identity:85/307 - (27%)
Similarity:130/307 - (42%) Gaps:40/307 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQV-------QTQR-MGISECMHIMLNEGGSRSMWRGNG 343
            :..:|||:.|..:.....|||.|||.||.       |..| .|:.:|........|.|..:||..
  Fly    16 KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGIS 80

  Fly   344 INVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLAL 408
            ..::.:.|..|..||.|...|||.:.||..| ::..:.|.|||.||..|..:..|.:.:|..|..
  Fly    81 APLVGVTPIYAVDFAVYAAGKRLFQTD
DHIR-LTYPQIFAAGALAGVCSALVTVPTDRIKVLLQT 144

  Fly   409 RRTGQ----YAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLK---RRYIANH 466
            :....    |.|..|.|.|:|:|.|:||.::|....||...| .|.....||.|:   |:..||.
  Fly   145 QTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQELARKKSANG 208

  Fly   467 DNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEE 531
            ..:...:.|    .|.|:..:....:.|..::::|||:....|..:..|                
  Fly   209 KISTTSTIL----SGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIR---------------- 253

  Fly   532 TMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRAL 578
               .:||.::..||...|:|||.|..|:..|:.:..:...|.|:..|
  Fly   254 ---SVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 28/90 (31%)
Mito_carr 375..463 CDD:278578 29/94 (31%)
Mito_carr 470..581 CDD:278578 23/109 (21%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 28/90 (31%)
Mito_carr 111..205 CDD:278578 30/95 (32%)
Mito_carr 208..297 CDD:278578 22/111 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.