DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Rim2

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:364 Identity:87/364 - (23%)
Similarity:137/364 - (37%) Gaps:108/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 HLVAGGIAGAVSRTCTAPLDRIKVYLQVQT----------------------------QR----- 319
            ||:|||.||.|....|.||:.:|..||..|                            ||     
  Fly    11 HLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLST 75

  Fly   320 ------------------MGISEC----------------MHIMLNEGGSRSMWRGNGINVLKIA 350
                              |.||.|                .||:.|| |.|::::|.|.|::.:|
  Fly    76 TILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNE-GPRALFKGLGPNLVGVA 139

  Fly   351 PETAFKFAAYEQMKRLIRGDDGSRQMSIVER------FYAGAAAGGISQTIIYPMEVLKTRLALR 409
            |..|..|..|.|.|..:      ..:..|||      ..:.|:||.:|.|...|:..:|||:.|.
  Fly   140 PSRAIYFCTYSQTKNTL
------NSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQLD 198

  Fly   410 RTGQ-YAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANH-----DN 468
            ...: ...:.....::|.|.||.:||:|...:..||.. ..:...:||.:|.:.:...     |.
  Fly   199 YNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICE-TMVHFVIYEFIKSKLLEQRNQRHTDT 262

  Fly   469 NEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETM 533
            .....||..:..|:.|.|:....:||..:.||||:.:                 .:..:|..:|:
  Fly   263 KGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREE-----------------GNKYNSFWQTL 310

  Fly   534 TGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYE 572
                ..:.::||..|||||:....::.:|..:|....||
  Fly   311 ----HTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 37/148 (25%)
Mito_carr 375..463 CDD:278578 25/94 (27%)
Mito_carr 470..581 CDD:278578 24/103 (23%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 37/145 (26%)
Mito_carr 163..253 CDD:278578 24/90 (27%)
Mito_carr 268..355 CDD:278578 24/99 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.