DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Ucp4A

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:376 Identity:70/376 - (18%)
Similarity:142/376 - (37%) Gaps:101/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 APSTDIHDL--IKFWRHSTYLDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLD 307
            |||:..|.|  :||                 |:......|      .:...:|.:::...|.|||
  Fly    21 APSSGRHQLRPVKF-----------------DYADSFACT------YIVSVVAASIAELATYPLD 62

  Fly   308 RIKVYLQVQ------------TQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAY 360
            ..|..||:|            .|..|:......:..|.|:..:|:|....:.:....:..:..:|
  Fly    63 LTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSY 127

  Fly   361 EQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAG-------IA 418
            :.|::... .:|::.:.:.:....|..||.::|.:..|.:::|.::.:....:..|       ..
  Fly   128 DLMRKEFT-QNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAG 191

  Fly   419 DAAVKIYKQEGVRSFYRGYVPNI-------LGILPYAGIDLAVYETLKRRYIANHDNNEQPS--- 473
            .|..:|.::.|::..::|.:||:       ||       ||..|:|:|...:   :..:.|.   
  Fly   192 HAFRQIVQRGGIKGLWKGSIPNVQRAALVNLG-------DLTTYDTIKHLIM---NRLQMPDCHT 246

  Fly   474 --FLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGL 536
              .|..:..|..::.:|.    |..:|:||:..|..                      :|...||
  Fly   247 VHVLASVCAGFVAAIMGT----PADVVKTRIMNQPT----------------------DENGRGL 285

  Fly   537 --------FRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALG 579
                    .|:.|.:||...||:|..|.::::.|.....::.:|...:.:|
  Fly   286 LYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 1/1 (100%)
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 17/96 (18%)
Mito_carr 375..463 CDD:278578 20/101 (20%)
Mito_carr 470..581 CDD:278578 23/123 (19%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 61/338 (18%)
Mito_carr 39..138 CDD:278578 18/105 (17%)
Mito_carr 142..239 CDD:278578 20/106 (19%)
Mito_carr 248..336 CDD:278578 21/113 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.