DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Ant2

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:284 Identity:82/284 - (28%)
Similarity:139/284 - (48%) Gaps:35/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GGIAGAVSRTCTAPLDRIKVYLQVQ--------TQR-MGISECMHIMLNEGGSRSMWRGNGINVL 347
            ||::.|:::|..||::|:|:.||||        .|| .||.:|...:..|.|..|.||||..||:
  Fly    25 GGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLANVI 89

  Fly   348 KIAPETAFKFAAYEQMKRL-IRGDDGSRQM--SIVERFYAGAAAGGISQTIIYPMEVLKTRLA-- 407
            :..|..|..||..:..|.: :.|.|..:|.  .......:|.|||..|...:||::..:||||  
  Fly    90 RYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRLAAD 154

  Fly   408 LRRTG--QYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNNE 470
            :.:.|  ::.|:.|..:|:.|.:|....|||::.::.||:.|.......|:|. |.::   .|.:
  Fly   155 VGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTC-RDFL---PNPK 215

  Fly   471 QPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTG 535
            ...|.|..|.....:|:..:.|||...||.|:..|:.      .:|:::..|:: ||        
  Fly   216 STPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSG------LKKSEMVYKNT-AH-------- 265

  Fly   536 LFRKIVRQEGLTGLYRGITPNFLK 559
            .:..|.:|||:...::|...|.::
  Fly   266 CWLVIAKQEGIGAFFKGALSNIIR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 31/87 (36%)
Mito_carr 375..463 CDD:278578 27/93 (29%)
Mito_carr 470..581 CDD:278578 21/90 (23%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 82/284 (29%)
Mito_carr 17..111 CDD:278578 31/85 (36%)
Mito_carr 119..215 CDD:278578 27/99 (27%)
Mito_carr 218..307 CDD:278578 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.