DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and Slc25a41

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_038939063.1 Gene:Slc25a41 / 301114 RGDID:1588585 Length:338 Species:Rattus norvegicus


Alignment Length:339 Identity:160/339 - (47%)
Similarity:213/339 - (62%) Gaps:38/339 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RHSTY--------LDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLDRIKVYLQ 314
            ||..:        ||.||.:.||.|..::| ..|..|:.|::|.:|||||||.||||||.:||:|
  Rat    21 RHQKFEVILNCLVLDTGEQLMVPGDVLEEE-NKGTLWKFLLSGAMAGAVSRTGTAPLDRARVYMQ 84

  Fly   315 VQTQRMGISECMHI------MLNEGGSRSMWRGNGINVLKIAPETAFKFAAYEQMKRLIRGDDGS 373
            |.:.:   |...|:      ::.|||.||:||||||||||||||.|.||:.:||.:....|...|
  Rat    85 VYSSK---SNFRHLLSGLRSLVQEGGIRSLWRGNGINVLKIAPEYAIKFSVFEQSRNFFYGVHTS 146

  Fly   374 RQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGYV 438
              .|..||..||:.|..||||:|.|||||||||.||.||||.|:.|.|.:|.:::|.|:.||||:
  Rat   147 --PSFQERVVAGSLAVAISQTLINPMEVLKTRLTLRFTGQYKGLLDCARQILERDGTRALYRGYL 209

  Fly   439 PNILGILPYAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQ 503
            ||:|||:|||..||||||.|:..:..:..:.:.||.||.|:..:.|:|.||:.||||.|||||:|
  Rat   210 PNMLGIIPYACTDLAVYELLRCLWQKSGRDMKDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQ 274

  Fly   504 AQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISY 568
            ||  :|:                .....||.|:|::|:.|:|..|||||:||..||||||..|||
  Rat   275 AQ--DTV----------------EGSNPTMLGVFKRILNQQGWPGLYRGMTPTLLKVLPAGGISY 321

  Fly   569 VVYEYTSRALGIKM 582
            :|||...:.||:::
  Rat   322 LVYEAMKKTLGVQV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 46/90 (51%)
Mito_carr 375..463 CDD:278578 51/87 (59%)
Mito_carr 470..581 CDD:278578 50/110 (45%)
Slc25a41XP_038939063.1 PTZ00169 49..331 CDD:240302 149/305 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5177
eggNOG 1 0.900 - - E1_KOG0036
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333952at33208
OrthoFinder 1 1.000 - - FOG0000464
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X287
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.