DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and SPAC17H9.08

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_593578.1 Gene:SPAC17H9.08 / 2542177 PomBaseID:SPAC17H9.08 Length:326 Species:Schizosaccharomyces pombe


Alignment Length:332 Identity:87/332 - (26%)
Similarity:154/332 - (46%) Gaps:57/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 WRHLV----AGGIAGAVSRTCTAPLDRIKVYLQVQ--------TQRMGISECMHIMLNEGGSRSM 338
            |..||    |||.||.|:::..|||||:|:..|..        ..|.|:.:.:..:.:..|...:
pombe    14 WEFLVKSGIAGGTAGCVAKSVVAPLDRVKILYQTNHASYRGYAYSRHGLYKAIKHIYHVYGLHGL 78

  Fly   339 WRGNGINVLKIAPETAFKFAAYEQMKR-LIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVL 402
            ::|:...:.::.|....||.||||::| |||..:....   ..||.:|:.||..|....||:|::
pombe    79 YQGHTATLYRVFPYAGIKFVAYEQVRRVLIRD
PEHETH---ARRFLSGSLAGTCSVFFTYPLELI 140

  Fly   403 KTRLA-LRRTGQYAGIADAAVKIYKQEG---------------VRSFYRGYVPNILGILPYAGID 451
            :.||| :..||:...:......|:.:..               :.:||||:...:.||.||||:.
pombe   141 RVRLAYITNTGKNPTLTQVTKDIFHERDFLCNKKYPGLSRLSKICNFYRGFSVTLTGIFPYAGMS 205

  Fly   452 LAVYETL-----KRR---YIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAE 508
            ...|:..     |::   :::...::::......|.||:.:...||..|||..:.|.::|.... 
pombe   206 FLAYDLATDFFHKQK
IDEWVSTKKSDKKLKTWPELLCGAFAGVCGQTVSYPFEVCRRKMQIGGI- 269

  Fly   509 TIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEY 573
                :|.|:.:.||.            :.:...::.|:.|.:.|:|..::||:|.||.|:.||.:
pombe   270 ----RKNKSFLRLKQ------------VVQTTYKEAGMRGFFVGLTIGYIKVIPMVSTSFFVYNH 318

  Fly   574 TSRALGI 580
            :...|||
pombe   319 SKALLGI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 31/96 (32%)
Mito_carr 375..463 CDD:278578 27/111 (24%)
Mito_carr 470..581 CDD:278578 29/111 (26%)
SPAC17H9.08NP_593578.1 Mito_carr 13..110 CDD:278578 30/95 (32%)
Mito_carr 112..220 CDD:278578 27/110 (25%)
Mito_carr 232..324 CDD:278578 26/108 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1887
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.